PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 916656
Common NameARALYDRAFT_916656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 367aa    MW: 39650.8 Da    PI: 6.5747
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
916656genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53e-1397141347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
           916656  97 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKY 141
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.4490146IPR017930Myb domain
SuperFamilySSF466892.01E-1792147IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1893145IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-1194140IPR009057Homeodomain-like
SMARTSM007173.6E-1194144IPR001005SANT/Myb domain
CDDcd001672.71E-997142No hitNo description
PfamPF002497.0E-1197141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MTRRCSHCNH NGHNSRTCPN RGVKLFGVRL TEGSIRKSAS MGNLSHYTGS GSGGHGTGSN  60
TPGSPGDVPD HVAGDGYASE DFVAGSSSSR ERKKGTPWTE EEHRMFLLGL QKLGKGDWRG  120
ISRNYVTTRT PTQVASHAQK YFIRQSNVSR RKRRSSLFDM VPDEVGDIPM DLQEPEADNI  180
PVETEMQGAD SVHQTLAPGT LQAPSILEIE ECESMDSTNS TNGEPTATAA AASSSSSRLE  240
ETTQLQSQLQ PQPQLPGSFP ILYPTYFSPY YPFPFPIWPA GYVPEPPKKE ETHEILRPTA  300
VHSKAPINVD ELLGMSKLSL AESNKNGESD QSLSLKLGGG SSSRQSAFHP NPSSDSSDIK  360
SVIHAL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269310.0AK226931.1 Arabidopsis thaliana mRNA for Myb-related transcription activator-like, complete cds, clone: RAFL09-26-D04.
GenBankAY0720770.0AY072077.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At5g47390) mRNA, complete cds.
GenBankAY0842950.0AY084295.1 Arabidopsis thaliana clone 102806 mRNA, complete sequence.
GenBankAY0966610.0AY096661.1 Arabidopsis thaliana putative Myb-related transcription activator (At5g47390) mRNA, complete cds.
GenBankAY5195160.0AY519516.1 Arabidopsis thaliana MYB transcription factor (At5g47390) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865122.10.0myb family transcription factor
TrEMBLD7MPU20.0D7MPU2_ARALL; Myb family transcription factor
STRINGscaffold_800056.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.10.0MYB_related family protein